15th C. Horseman Graffiti, Calatrava la Vieja

0 Views
Find Similar (BETA)Download
Author name
Global Digital Heritage
Source
Sketchfab
Polygon Count
3,590,916
Release Date
2019-04-10
License
CC BY-NC 4.0
medievalgraffitigdhrealitycaptureglobaldigitalheritagecalatrava-la-vieja

Asset Overview

Medieval graffiti from Calatrava la Vieja, Castilla-La Mancha, Spain. Late medieval Christian period (15th century CE). They were discovered in 1984, during the excavation works carried out under the direction of the architect Miguel Fisac. They are located in the crypt of the Santa María La Blanca Church, inside the alcazar, and were made with a sharp object in the plaster of the south wall of the crypt. They represent several five-pointed stars, geometric forms and groups of parallel lines. The main motif is a man on horseback. There is also a small human figure in frontal view, dressed in a tunic. GDH Interior Graffiti Panel 3. Hervás Herrera, Miguel Ángel (2016): Calatrava la Vieja. Conservación y Restauración (1975-2010), Universidad de Castilla-La Mancha, Repositorio Digital RUIDERA, Albacete, 2016, 958 págs. URI: http://hdl.handle.net/10578/8711.