15th C. Hunting Graffiti, Calatrava la Vieja-Esp

4 Views
Find Similar (BETA)Download
Author name
Global Digital Heritage
Source
Sketchfab
Polygon Count
1,874,421
Release Date
2019-04-10
License
CC BY 4.0
medievalgraffitigdhrealitycaptureglobaldigitalheritagecalatrava-la-vieja

Asset Overview

Medieval graffiti from Calatrava la Vieja, Castilla-La Mancha, Spain. Late medieval Christian period (15th century CE). They were discovered in 1984, during the excavation works carried out under the direction of the architect Miguel Fisac. They are located in the crypt of the Santa María La Blanca Church, inside the alcazar, and were made with a sharp object in the plaster of the south wall of the crypt. They represent five-pointed stars, geometric forms, and several groups of lines. The main motif is a standing man who grasps a crossbow armed with a “virote” and points it at a deer located at a certain distance, which appears represented at a smaller size to give an idea of perspective. It´s a big game hunting scene. GDH Interior Graffiti Panel 4. Hervás Herrera, Miguel Ángel (2016): Calatrava la Vieja. Conservación y Restauración (1975-2010), Universidad de Castilla-La Mancha, Repositorio Digital RUIDERA, Albacete, 2016, 958 págs. URI: http://hdl.handle.net/10578/8711.

Recommended for you

Paint2_17